Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FAM70A Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$149.00 - $329.00
Specifications
| Antigen | FAM70A |
|---|---|
| Immunogen | Synthetic peptides corresponding to FAM70A(family with sequence similarity 70, member A) The peptide sequence was selected from the N terminal of FAM70A. Peptide sequence IVDGVFAARHIDLKPLYANRCHYVPKTSQKEAEEVISSSTKNSPSTRVMR. |
| Host Species | Rabbit |
| Primary or Secondary | Primary |
| Monoclonal or Polyclonal | Polyclonal |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
| NBP15997220 |
Novus Biologicals
NBP15997220UL |
20ul |
Each for $149.00
|
|
NBP159972 |
Novus Biologicals
NBP159972 |
100 ul |
Each for $329.00
|
|
Description
FAM70A Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.Specifications
| FAM70A | |
| Rabbit | |
| Polyclonal | |
| Unconjugated | |
| 55026 | |
| Affinity Purified | |
| Western Blot | |
| RUO |
| Synthetic peptides corresponding to FAM70A(family with sequence similarity 70, member A) The peptide sequence was selected from the N terminal of FAM70A. Peptide sequence IVDGVFAARHIDLKPLYANRCHYVPKTSQKEAEEVISSSTKNSPSTRVMR. | |
| Primary | |
| IgG | |
| family with sequence similarity 70, member A, FLJ20716, hypothetical protein LOC55026 | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| Immunogen affinity purified | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title