FAM76A Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155436

Catalog No. NBP155436

Description

FAM76A Polyclonal specifically detects FAM76A in Human samples. It is validated for Western Blot.

Specifications

• Antigen: FAM76A
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8TAV0
• Gene Symbols: FAM76A
• Immunogen: Synthetic peptides corresponding to FAM76A(family with sequence similarity 76, member A) The peptide sequence was selected from the middle region of FAM76A. Peptide sequence QCAFDRKDDRKKVDGKLLCWLCTLSYKRVLQKTKEQRKHLSSSSRAGHQE.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 199870
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: family with sequence similarity 76, member A, FLJ41946, hypothetical protein LOC199870, MGC34648
• Host Species: Rabbit
• Molecular Weight of Antigen: 35 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Zebrafish: 80%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG