Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FAM76A Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | FAM76A |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP155436
|
Novus Biologicals
NBP155436 |
100 μL |
Each of 1 for $436.00
|
|
Description
FAM76A Polyclonal specifically detects FAM76A in Human samples. It is validated for Western Blot.Specifications
FAM76A | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
family with sequence similarity 76, member A, FLJ41946, hypothetical protein LOC199870, MGC34648 | |
FAM76A | |
IgG | |
Affinity Purified | |
35 kDa |
Western Blot | |
Unconjugated | |
RUO | |
Q8TAV0 | |
199870 | |
Synthetic peptides corresponding to FAM76A(family with sequence similarity 76, member A) The peptide sequence was selected from the middle region of FAM76A. Peptide sequence QCAFDRKDDRKKVDGKLLCWLCTLSYKRVLQKTKEQRKHLSSSSRAGHQE. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title