Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FAM81A Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | FAM81A |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP179521
|
Novus Biologicals
NBP179521 |
100 μL |
Each of 1 for $436.00
|
|
Description
FAM81A Polyclonal specifically detects FAM81A in Human samples. It is validated for Western Blot.Specifications
FAM81A | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
family with sequence similarity 81, member A, hypothetical protein LOC145773, MGC26690 | |
FAM81A | |
IgG | |
Affinity Purified |
Western Blot | |
Unconjugated | |
RUO | |
NP_689663 | |
145773 | |
Synthetic peptide directed towards the N terminal of human FAM81AThe immunogen for this antibody is FAM81A. Peptide sequence GDRLARLFLEEHIRNITAIVKQLNRDIEVLQEQIRARDNISYGTNSALKT. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title