Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FAM90A1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | FAM90A1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15687520
|
Novus Biologicals
NBP15687520UL |
20 μL |
Each for $152.22
|
|
NBP156875
|
Novus Biologicals
NBP156875 |
100 μL |
Each for $436.00
|
|
Description
FAM90A1 Polyclonal specifically detects FAM90A1 in Human samples. It is validated for Western Blot.Specifications
| FAM90A1 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q86YD7 | |
| 55138 | |
| Synthetic peptides corresponding to FAM90A1(family with sequence similarity 90, member A1) The peptide sequence was selected from the N terminal of FAM90A1. Peptide sequence PDEEDPRLKCKNCEAFGHTARSTRCPMKCWKAALVPPNFGEKEGKENLKP. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| family with sequence similarity 90, member A1, FLJ10408, hypothetical protein LOC55138 | |
| FAM90A1 | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title