FANCL Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP184759

Catalog No. NBP184759

Description

FANCL Polyclonal specifically detects FANCL in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: FANCL
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: E3 ubiquitin-protein ligase FANCL, EC 6.3.2.-, FAAP43PHF9FLJ10335, Fanconi anemia group L protein, Fanconi anemia, complementation group L, Fanconi anemia-associated polypeptide of 43 kDa, PHD finger protein 9, Pog
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: FANCL
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:FPARAILEKSDFTMDCGICYAYQLDGTIPDQVCDNSQCGQPFHQICLYEWLRGLLTSRQSFNIIFGECPYCSKPIT
• Quantity: 0.1 mL
• Research Discipline: Cancer, DNA Repair, Genes Sensitive to DNA Damaging Agents
• Gene ID (Entrez): 55120
• Target Species: Human
• Isotype: IgG

For Research Use Only