Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. FANK1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

FANK1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$149.00 - $329.00

Specifications

Antigen FANK1
Immunogen Synthetic peptides corresponding to Fank1 (fibronectin type 3 and ankyrin repeat domains 1) The peptide sequence was selected from the middle region of Fank1. Peptide sequence LLLRILEGGHVMIDVPNKFGFTALMVAAQKGYTRLVKILVSNGTDVNLKN.
Host Species Rabbit
Primary or Secondary Primary
Monoclonal or Polyclonal Polyclonal
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP16900920 View Documents
View Product Certificates
Novus BiologicalsSupplier Diversity Partner
NBP16900920UL 		20ul Each for $149.00
Add to cart
 
NBP169009 View Documents
View Product Certificates
Novus BiologicalsSupplier Diversity Partner
NBP169009 		100 ul Each for $329.00
Add to cart
 
Description

Description

FANK1 Polyclonal antibody specifically detects Antigen in Mouse samples. It is validated for Western Blotting.
Specifications

Specifications

FANK1
Rabbit
Polyclonal
Unconjugated
92565
Affinity Purified
Western Blot
RUO
Synthetic peptides corresponding to Fank1 (fibronectin type 3 and ankyrin repeat domains 1) The peptide sequence was selected from the middle region of Fank1. Peptide sequence LLLRILEGGHVMIDVPNKFGFTALMVAAQKGYTRLVKILVSNGTDVNLKN.
Primary
IgG
1700007B22Rik, fibronectin type 3 and ankyrin repeat domains 1, fibronectin type 3 and ankyrin repeat domains protein 1, fibronectin type III and ankyrin repeat domains 1
PBS and 2% Sucrose with 0.09% Sodium Azide
Immunogen affinity purified
Store at -20C. Avoid freeze-thaw cycles.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit