Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FANK1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen FANK1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP169009
View Documents
Novus Biologicals
NBP169009
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

FANK1 Polyclonal specifically detects FANK1 in Mouse samples. It is validated for Western Blot.
Specifications

Specifications

FANK1
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
1700007B22Rik, fibronectin type 3 and ankyrin repeat domains 1, fibronectin type 3 and ankyrin repeat domains protein 1, fibronectin type III and ankyrin repeat domains 1
FANK1
IgG
Affinity Purified
38 kDa
Western Blot
Unconjugated
RUO
Q9DAM9
92565
Synthetic peptides corresponding to Fank1 (fibronectin type 3 and ankyrin repeat domains 1) The peptide sequence was selected from the middle region of Fank1. Peptide sequence LLLRILEGGHVMIDVPNKFGFTALMVAAQKGYTRLVKILVSNGTDVNLKN.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit