Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FANK1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | FANK1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP169009
|
Novus Biologicals
NBP169009 |
100 μL |
Each of 1 for $436.00
|
|
Description
FANK1 Polyclonal specifically detects FANK1 in Mouse samples. It is validated for Western Blot.Specifications
FANK1 | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
1700007B22Rik, fibronectin type 3 and ankyrin repeat domains 1, fibronectin type 3 and ankyrin repeat domains protein 1, fibronectin type III and ankyrin repeat domains 1 | |
FANK1 | |
IgG | |
Affinity Purified | |
38 kDa |
Western Blot | |
Unconjugated | |
RUO | |
Q9DAM9 | |
92565 | |
Synthetic peptides corresponding to Fank1 (fibronectin type 3 and ankyrin repeat domains 1) The peptide sequence was selected from the middle region of Fank1. Peptide sequence LLLRILEGGHVMIDVPNKFGFTALMVAAQKGYTRLVKILVSNGTDVNLKN. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title