Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FAR1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$204.00 - $482.50
Specifications
| Antigen | FAR1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP19135720
|
Novus Biologicals
NBP19135720UL |
20 μL |
Each for $204.00
|
|
|||||
|
NBP191357
|
Novus Biologicals
NBP191357 |
100 μL |
Each for $482.50
|
|
|||||
Description
FAR1 Polyclonal specifically detects FAR1 in Human samples. It is validated for Western Blot.Specifications
| FAR1 | |
| Polyclonal | |
| Purified | |
| RUO | |
| fatty acyl CoA reductase 1, FLJ22728, FLJ33561, short chain dehydrogenase/reductase family 10E, member 1, UNQ2423/PRO4981 | |
| FAR1 | |
| IgG | |
| Protein A purified |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| NP_115604 | |
| 84188 | |
| Synthetic peptide directed towards the N terminal of human MLSTD2. Peptide sequence LRSCPKVNSVYVLVRQKAGQTPQERVEEVLSGKLFDRLRDENPDFREKII. | |
| Primary |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title