Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Fascin 2 Rabbit, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP17977620UL

 View more versions of this product

Catalog No. NBP17977620


Add to cart

Description

Description

Fascin 2 Polyclonal antibody specifically detects Antigen in Human, Rat samples. It is validated for Western Blotting.
Specifications

Specifications

Fascin 2
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
FSCN2
Synthetic peptide directed towards the middle region of human FSCN2. Peptide sequence AGTLKAGRNTRPGKDELFDLEESHPQVVLVAANHRYVSVRQGVNVSANQD.
57 kDa
20ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human, Rat
Western Blot
Western Blot 1:1000
NP_001070650
fascin homolog 2, actin-bundling protein, retinal (Strongylocentrotuspurpuratus), fascin-2, Retinal fascin, retinal), RFSNRP30fascin (Strongylocentrotus purpuratus) homolog 2 (actin-bundling protein
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
25794
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit