Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Fascin Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | Fascin |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP174212
|
Novus Biologicals
NBP174212 |
100 μL |
Each of 1 for $436.00
|
|
Description
Fascin Polyclonal specifically detects Fascin in Mouse samples. It is validated for Western Blot.Specifications
Fascin | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
FAN1,55 kDa actin-bundling protein, fascin homolog 1, actin-bundling protein (Strongylocentrotus purpuratus), FLJ38511, HSN, p55actin bundling protein, singed (Drosophila)-like (sea urchin fascin homolog like), singed-like (fascin homolog, sea urchin), Singed-like protein, SNLfascin | |
FSCN1 | |
IgG | |
Affinity Purified |
Western Blot | |
Unconjugated | |
RUO | |
Q61553 | |
6624 | |
Synthetic peptides corresponding to the N terminal of Fscn1. Immunizing peptide sequence VVAHDDGRWSLQSEAHRRYFGGTEDRLSCFAQSVSPAEKWSVHIAMHPQV. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title