Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FASTKD2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | FASTKD2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP155360
|
Novus Biologicals
NBP155360 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
FASTKD2 Polyclonal specifically detects FASTKD2 in Human samples. It is validated for Western Blot.Specifications
| FASTKD2 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| FAST kinase domains 2, KIAA0971FAST kinase domain-containing protein 2 | |
| FASTKD2 | |
| IgG | |
| Affinity Purified | |
| 81 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9NYY8 | |
| 22868 | |
| Synthetic peptides corresponding to FASTKD2(FAST kinase domains 2) The peptide sequence was selected from the middle region of FASTKD2. Peptide sequence DTNRNQVLPLSDVDTTSATDIQRVAVLCVSRSAYCLGSSHPRGFLAMKMR. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title