Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FAT10 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15833720UL
Description
FAT10 Polyclonal specifically detects FAT10 in Human samples. It is validated for Western Blot.Specifications
FAT10 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
O15205 | |
UBD | |
Synthetic peptides corresponding to UBD(ubiquitin D) The peptide sequence was selected from the N terminal of UBD. Peptide sequence RSKTKVPVQDQVLLLGSKILKPRRSLSSYGIDKEKTIHLTLKVVKPSDEE. | |
Affinity Purified | |
RUO | |
10537 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
Diubiquitin, FAT10diubiquitin, GABBR1, UBD-3, ubiquitin D, Ubiquitin-like protein FAT10 | |
Rabbit | |
18 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title