Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FBXL3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | FBXL3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP153021
|
Novus Biologicals
NBP153021 |
100 μL |
Each for $436.00
|
|
NBP1530220
|
Novus Biologicals
NBP15302120UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
FBXL3 Polyclonal specifically detects FBXL3 in Human samples. It is validated for Western Blot.Specifications
| FBXL3 | |
| Polyclonal | |
| Rabbit | |
| Q9UKT7 | |
| 26224 | |
| Synthetic peptides corresponding to FBXL3(F-box and leucine-rich repeat protein 3) The peptide sequence was selected from the middle region of FBXL3. Peptide sequence LISTARPSFMDLPKSHFISALTVVFVNSKSLSSLKIDDTPVDDPSLKVLV. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FBL3AF-box and leucine-rich repeat protein 3AF-box protein Fbl3a, FBL3F-box/LRR-repeat protein 3, F-box and leucine-rich repeat protein 3, F-box/LRR-repeat protein 3A, FBXL3A | |
| FBXL3 | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title