Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FBXO24 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP24745725UL
Description
FBXO24 Polyclonal specifically detects FBXO24 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
FBXO24 | |
Polyclonal | |
Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
DKFZp434I1122, F-box protein 24, F-box protein Fbx24, FBX24F-box only protein 24 | |
Rabbit | |
Affinity Purified | |
RUO | |
26261 | |
Human | |
IgG |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
FBXO24 | |
This antibody was developed against a recombinant protein corresponding to amino acids: IYSLVVNETQLDQPRSYTVQLALRKVSHYLPHLRVACMTSNQSSTLYVTDQGGVYFEVHTPGVYRDLFGTLQA | |
25 μL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?
Product Content Correction