Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FBXO25 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | FBXO25 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP155044
|
Novus Biologicals
NBP155044 |
100 μL |
Each of 1 for $482.50
|
|
|||||
Description
FBXO25 Polyclonal specifically detects FBXO25 in Human samples. It is validated for Western Blot.Specifications
FBXO25 | |
Polyclonal | |
Rabbit | |
Q8TCJ0 | |
26260 | |
Synthetic peptides corresponding to FBXO25(F-box protein 25) The peptide sequence was selected from the N terminal of FBXO25. Peptide sequence LGEAFNRLDFSSAIQDIRRFNYVVKLLQLIAKSQLTSLSGVAQKNYFNIL. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
F-box protein 25, F-box protein Fbx25, FBX25F-box only protein 25, MGC20256, MGC51975 | |
FBXO25 | |
IgG | |
34 kDa |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title