Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FBXO34 Rabbit, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody



Antigen FBXO34
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
View Documents
Novus Biologicals
100 μL
Each of 1 for $436.00
Add to cart


FBXO34 Polyclonal specifically detects FBXO34 in Mouse, Rat samples. It is validated for Western Blot.


PBS and 2% Sucrose with 0.09% Sodium Azide
Synthetic peptides corresponding to Fbxo34 (F-box protein 34) The peptide sequence was selected from the N terminal of Fbxo34. Peptide sequence RDTLRTPMSHGKANGDVKARASYMKPTVLPSASLVKASSRKPFGILSPNV.
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
DKFZp547C162, F-box only protein 34, F-box protein 34, FBX34, FLJ20725, MGC126434, MGC126435, protein CGI-301
Affinity Purified
82 kDa
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit