Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FBXO36 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | FBXO36 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP157616
|
Novus Biologicals
NBP157616 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
FBXO36 Polyclonal specifically detects FBXO36 in Human samples. It is validated for Western Blot.Specifications
| FBXO36 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| F-box only protein 36, F-box protein 36, FBX36, FLJ37592, FLJ41090 | |
| FBXO36 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q8NEA4 | |
| 130888 | |
| Synthetic peptides corresponding to FBXO36(F-box protein 36) The peptide sequence was selected from the N terminal of FBXO36. Peptide sequence QVIFRWWKISLRSEYRSTKPGEAKETHEDFLENSHLQGQTALIFGARILD. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title