Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FBXO42 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | FBXO42 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP156643
|
Novus Biologicals
NBP156643 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
FBXO42 Polyclonal specifically detects FBXO42 in Human samples. It is validated for Western Blot.Specifications
| FBXO42 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| F-box only protein 42, F-box protein 42, Fbx42, JFK, Just one F-box and Kelch domain-containing protein, KIAA1332FBX42 | |
| FBXO42 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q6P3S6 | |
| 54455 | |
| Synthetic peptides corresponding to FBXO42(F-box protein 42) The peptide sequence was selected from the middle region of FBXO42. Peptide sequence RSMDEAPCVNGRWGTLRPRAQRQTPSGSREGSLSPARGDGSPILNGGSLS. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title