Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FBXO42 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen FBXO42
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP156643
View Documents
Novus Biologicals
NBP156643
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

FBXO42 Polyclonal specifically detects FBXO42 in Human samples. It is validated for Western Blot.
Specifications

Specifications

FBXO42
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
F-box only protein 42, F-box protein 42, Fbx42, JFK, Just one F-box and Kelch domain-containing protein, KIAA1332FBX42
FBXO42
IgG
Affinity Purified
Western Blot
Unconjugated
RUO
Q6P3S6
54455
Synthetic peptides corresponding to FBXO42(F-box protein 42) The peptide sequence was selected from the middle region of FBXO42. Peptide sequence RSMDEAPCVNGRWGTLRPRAQRQTPSGSREGSLSPARGDGSPILNGGSLS.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit