Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FBXO8 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15531720UL
Description
FBXO8 Polyclonal specifically detects FBXO8 in Human samples. It is validated for Western Blot.Specifications
FBXO8 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q9NRD0 | |
FBXO8 | |
Synthetic peptides corresponding to FBXO8(F-box protein 8) The peptide sequence was selected from the middle region of FBXO8. Peptide sequence EFFRHIHAPEERGEYLETLITKFSHRFCACNPDLMRELGLSPDAVYVLCY. | |
Affinity Purified | |
RUO | |
26269 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
F-box only protein 8, F-box protein 8, F-box/SEC7 protein FBS, FBSFBX8F-box protein Fbx8 | |
Rabbit | |
37 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title