FBXW10 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Supplier:  Novus Biologicals NBP179495

Catalog No. NBP179495

Description

FBXW10 Polyclonal specifically detects FBXW10 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: FBXW10
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: F-box and WD repeat domain containing 10, F-box protein, F-box/WD repeat-containing protein 10
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10517
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: FBXW10
• Immunogen: Synthetic peptide directed towards the N terminal of human FBXW10The immunogen for this antibody is FBXW10. Peptide sequence SPEKDHSSKSATSQVYWTAKTQHTSLPLSKAPENEHLLGAASNPEEPWRN.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Crab-eating macaque: 85%.
• Target Species: Human
• Isotype: IgG