Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FBXW10 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP17949620UL

 View more versions of this product

Catalog No. NBP17949620


Add to cart

Description

Description

FBXW10 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

FBXW10
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
F-box and WD repeat domain containing 10, F-box protein, F-box/WD repeat-containing protein 10
Rabbit
IgG
20ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human
Western Blot
Western Blot 1:1000
Affinity Purified
FBXW10
Synthetic peptide directed towards the middle region of human FBXW10The immunogen for this antibody is FBXW10. Peptide sequence RKIHLLDIIQVKAIPVEFRGHAGSVRALFLCEEENFLLSGSYDLSIRYWD.
Immunogen affinity purified
RUO
Primary
10517
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit