Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FBXW10 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

$436.00

Specifications

Antigen FBXW10
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP179495
View Documents
Novus Biologicals
NBP179495
100 μL
Each for $436.00
Add to cart
 
NBP17949520
View Documents
Novus Biologicals
NBP17949520UL
20 μL This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. N/A
Description

Description

FBXW10 Polyclonal specifically detects FBXW10 in Human samples. It is validated for Western Blot.
Specifications

Specifications

FBXW10
Polyclonal
Rabbit
Human
F-box and WD repeat domain containing 10, F-box protein, F-box/WD repeat-containing protein 10
FBXW10
IgG
Affinity Purified
Western Blot
Unconjugated
RUO
PBS and 2% Sucrose with 0.09% Sodium Azide
10517
Synthetic peptide directed towards the N terminal of human FBXW10The immunogen for this antibody is FBXW10. Peptide sequence SPEKDHSSKSATSQVYWTAKTQHTSLPLSKAPENEHLLGAASNPEEPWRN.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit