FBXW11 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155069

Catalog No. NBP155069

Description

FBXW11 Polyclonal specifically detects FBXW11 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: FBXW11
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9UKB1
• Gene Symbols: FBXW11
• Immunogen: Synthetic peptides corresponding to FBXW11(F-box and WD repeat domain containing 11) The peptide sequence was selected from the N terminal of FBXW11. Peptide sequence EPDSVIEDKTIELMNTSVMEDQNEDESPKKNTLWQISNGTSSVIVSRKRP.
• Quantity: 100 μL
• Research Discipline: Signal Transduction, Wnt Signaling Pathway
• Gene ID (Entrez): 23291
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS & 2% Sucrose. with 0.09% Sodium Azide
• Gene Alias: beta-transducin repeat-containing protein 2, BTRC2F-box/WD repeat-containing protein 1B, BTRCP2FBW1B, F-box and WD repeat domain containing 11, F-box and WD-40 domain protein 11, F-box and WD-40 domain protein 1B, F-box protein Fbw1b, F-box/WD repeat-containing protein 11, Fbw11, FBXW1BFbw1b, Homologous to Slimb protein, Hos, KIAA0696F-box and WD repeats protein beta-TrCP2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Chicken: 100%; Canine: 100%; Guinea pig: 100%; Human: 100%; Rabbit: 100%; Bovine: 92%; Mouse: 85%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Guinea Pig, Rabbit
• Isotype: IgG