Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FBXW11 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen FBXW11
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP155069
View Documents
Novus Biologicals
NBP155069
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

FBXW11 Polyclonal specifically detects FBXW11 in Human samples. It is validated for Western Blot.
Specifications

Specifications

FBXW11
Polyclonal
Rabbit
Signal Transduction, Wnt Signaling Pathway
beta-transducin repeat-containing protein 2, BTRC2F-box/WD repeat-containing protein 1B, BTRCP2FBW1B, F-box and WD repeat domain containing 11, F-box and WD-40 domain protein 11, F-box and WD-40 domain protein 1B, F-box protein Fbw1b, F-box/WD repeat-containing protein 11, Fbw11, FBXW1BFbw1b, Homologous to Slimb protein, Hos, KIAA0696F-box and WD repeats protein beta-TrCP2
FBXW11
IgG
Affinity Purified
Western Blot
Unconjugated
RUO
Q9UKB1
23291
Synthetic peptides corresponding to FBXW11(F-box and WD repeat domain containing 11) The peptide sequence was selected from the N terminal of FBXW11. Peptide sequence EPDSVIEDKTIELMNTSVMEDQNEDESPKKNTLWQISNGTSSVIVSRKRP.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit