Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FCRN/FCGRT Mouse anti-Human, Clone: CL3638, Novus Biologicals™

Mouse Monoclonal Antibody

Manufacturer:  Novus Biologicals NBP261626

Catalog No. NBP261626


Add to cart

Description

Description

FCRN/FCGRT Monoclonal antibody specifically detects FCRN/FCGRT in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications

Specifications

FCRN/FCGRT
CL3638
Immunohistochemistry 1:200 - 1:500
Purified
FCGRT
This antibody was developed against a recombinant protein corresponding to amino acids: LTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKS
Protein A purified
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Monoclonal
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunohistochemistry
Unconjugated
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
alpha-chain, Fc fragment of IgG, receptor, transporter, alpha, FcRn, FcRn alpha chain, FCRNimmunoglobulin receptor, intestinal, heavy chain, IgG Fc fragment receptor transporter alpha chain, IgG receptor FcRn large subunit p51, major histocompatibility complex class I-like Fc receptor, Neonatal Fc receptor, neonatal Fc-receptor for Ig
Mouse
IgG2a
100 ul
Primary
2217
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit