Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FDCSP Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
Supplier: Novus Biologicals NBP18470225UL
Description
FDCSP Polyclonal specifically detects FDCSP in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
FDCSP | |
Polyclonal | |
Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
C4orf7, chromosome 4 open reading frame 7, FDCSP, FDC-SP, FDC-SPFDC secreted protein, follicular dendritic cell secreted peptide, MGC71894 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
FDCSP | |
This antibody was developed against Recombinant Protein corresponding to amino acids:KRSISDSDELASGFFVFPYPYPFRPLPPIPFPRFPWFRRNFPIPIPESAPTTPL | |
25 μL | |
Immunology | |
260436 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?
Product Content Correction