Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FDFT1 Rabbit, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
$152.22 - $436.00
Specifications
| Antigen | FDFT1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15485520
|
Novus Biologicals
NBP15485520UL |
20 μL |
Each for $152.22
|
|
NBP154855
|
Novus Biologicals
NBP154855 |
100 μL |
Each for $436.00
|
|
Description
FDFT1 Polyclonal specifically detects FDFT1 in Human, Bovine samples. It is validated for Western Blot.Specifications
| FDFT1 | |
| Polyclonal | |
| Purified | |
| RUO | |
| P37268 | |
| 2222 | |
| Synthetic peptide directed towards the N terminal of human FDFT1 (NP_004453). Peptide sequence HSFLYQPDWRFMESKEKDRQVLEDFPTISLEFRNLAEKYQTVIADICRRM. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| DGPT, EC 2.5.1.21, ERG9, Farnesyl-diphosphate farnesyltransferase, farnesyl-diphosphate farnesyltransferase 1, FPP:FPP farnesyltransferase, presqualene-di-diphosphate synthase, SQS, squalene synthase, squalene synthetase, SS | |
| FDFT1 | |
| IgG | |
| Protein A purified | |
| 48 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title