Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FECH Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP15486320UL

 View more versions of this product

Catalog No. NBP15486320


Add to cart

Description

Description

FECH Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blotting.
Specifications

Specifications

FECH
Unconjugated
PBS & 2% Sucrose. with No Preservative
Affinity Purified
FECH
Synthetic peptides corresponding to FECH(ferrochelatase (protoporphyria)) The peptide sequence was selected from the N terminal of FECH. Peptide sequence QHAQGAKPQVQPQKRYESNIRKPKTGILMLNMGGPETLGDVHDFLLRLFL.
Immunogen affinity purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human
Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Q8NAN0
EC 4.99.1.1, EPP, FCE, ferrochelatase, ferrochelatase (protoporphyria), ferrochelatase, mitochondrial, Heme synthase, heme synthetase, Protoheme ferro-lyase, protoporphyria
Rabbit
IgG
20ul
Lipid and Metabolism
Primary
2235
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit