Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Ferredoxin Reductase Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | Ferredoxin Reductase |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP154789
|
Novus Biologicals
NBP154789 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
Ferredoxin Reductase Polyclonal specifically detects Ferredoxin Reductase in Human samples. It is validated for Western Blot.Specifications
| Ferredoxin Reductase | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| Adrenodoxin reductase, ADXREC 1.18.1.2, ferredoxin reductaseAR, Ferredoxin--NADP(+) reductase, NADPH:adrenodoxin oxidoreductase, mitochondrial | |
| FDXR | |
| IgG | |
| Affinity Purified | |
| 54 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| P22570 | |
| 2232 | |
| Synthetic peptides corresponding to FDXR(ferredoxin reductase) The peptide sequence was selected from the middle region of FDXR. Peptide sequence LDPVDFLGLQDKIKEVPRPRKRLTELLLRTATEKPGPAEAARQASASRAW. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title