Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Ferritin Heavy Chain Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
| Antigen | Ferritin Heavy Chain |
|---|---|
| Dilution | Western Blot 1.0 ug/ml, Immunohistochemistry |
| Applications | Western Blot, Immunohistochemistry |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NB123549
|
Novus Biologicals
NBP309324100UL |
100 μg |
Each of 1 for $482.50
|
|
|||||
Description
Ferritin Heavy Chain Polyclonal specifically detects Ferritin Heavy Chain in Human samples. It is validated for Western Blot, Immunohistochemistry.Specifications
| Ferritin Heavy Chain | |
| Western Blot, Immunohistochemistry | |
| Unconjugated | |
| Rabbit | |
| Lipid and Metabolism | |
| PBS buffer, 2% sucrose | |
| 2495 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot 1.0 ug/ml, Immunohistochemistry | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| apoferritin, Cell proliferation-inducing gene 15 protein, Ferritin H subunit, ferritin heavy chain, ferritin, heavy polypeptide 1, FHC, FTHEC 1.16.3.1, FTHL6MGC104426, PIG15, placenta immunoregulatory factor, PLIF, proliferation-inducing protein 15 | |
| The immunogen is a synthetic peptide directed towards the middle region of human Ferritin Heavy Chain (NP_002023). Peptide sequence NVNQSLLELHKLATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKM | |
| Affinity purified |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title