Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FFAR1/GPR40 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP288644

Catalog No. NB036266


Add to cart

Description

Description

FFAR1/GPR40 Polyclonal specifically detects FFAR1/GPR40 in Human samples. It is validated for Western Blot.
Specifications

Specifications

FFAR1/GPR40
Unconjugated
PBS, 2% Sucrose
free fatty acid receptor 1, G protein-coupled receptor 40, GPCR40, GPR40FFA1R, G-protein coupled receptor 40
The immunogen is a synthetic peptide directed towards the N-terminal region of human FFAR1/GPR40. Peptide sequence: KVSEAALSLLVLILIITSASRSQPKVPEWVNTPSTCCLKYYEKVLPRRLV
100 μg
GPCR
Primary
2864
Western Blot
Western Blot 1.0 ug/ml
Purified
Rabbit
Immunogen affinity purified
RUO
Store at 4°C short term. Aliquot and store at -20°:C long term. Avoid freeze-thaw cycles.
Polyclonal
Human
SDS
Documents
Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit