Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FGF-16 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Novus Biologicals NBP309433100UL
Description
FGF-16 Polyclonal specifically detects FGF-16 in Human samples. It is validated for Western Blot.Specifications
FGF-16 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
FGF-16, fibroblast growth factor 16 | |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human FGF-16 (NP_003859). Peptide sequence REQFEENWYNTYASTLYKHSDSERQYYVALNKDGSPREGYRTKRHQKFTH | |
100 μg | |
Angiogenesis | |
8823 | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human |
Safety and Handling
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title