Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FGF-16 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | FGF-16 |
---|---|
Dilution | Western Blot 1.0 ug/ml |
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NB123767
|
Novus Biologicals
NBP309433100UL |
100 μg |
Each of 1 for $482.50
|
|
|||||
Description
FGF-16 Polyclonal specifically detects FGF-16 in Human samples. It is validated for Western Blot.Specifications
FGF-16 | |
Western Blot | |
Unconjugated | |
Rabbit | |
Angiogenesis | |
PBS buffer, 2% sucrose | |
8823 | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot 1.0 ug/ml | |
Polyclonal | |
Purified | |
RUO | |
Human | |
FGF-16, fibroblast growth factor 16 | |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human FGF-16 (NP_003859). Peptide sequence REQFEENWYNTYASTLYKHSDSERQYYVALNKDGSPREGYRTKRHQKFTH | |
Affinity purified |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title