Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FGF14 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP16900620UL
Description
FGF14 Polyclonal specifically detects FGF14 in Human samples. It is validated for Western Blot.Specifications
FGF14 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q92915 | |
FGF14 | |
Synthetic peptides corresponding to FGF14 (fibroblast growth factor 14) The peptide sequence was selected from the middle region of FGF14. Peptide sequence ENYYVIYSSMLYRQQESGRAWFLGLNKEGQAMKGNRVKKTKPAAHFLPKP. | |
Affinity Purified | |
RUO | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
bA397O8.2, FGF-14, FHF4FHF-4, fibroblast growth factor 14, Fibroblast growth factor homologous factor 4, SCA27MGC119129 | |
Rabbit | |
28 kDa | |
20 μL | |
Angiogenesis, Neuroscience | |
2259 | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction