Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FGF14 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
Antigen | FGF14 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP16900620
|
Novus Biologicals
NBP16900620UL |
20 μL |
Each for $152.22
|
|
NBP169006
|
Novus Biologicals
NBP169006 |
100 μL |
Each for $436.00
|
|
Description
FGF14 Polyclonal specifically detects FGF14 in Human samples. It is validated for Western Blot.Specifications
FGF14 | |
Polyclonal | |
Rabbit | |
Angiogenesis, Neuroscience | |
Q92915 | |
2259 | |
Synthetic peptides corresponding to FGF14 (fibroblast growth factor 14) The peptide sequence was selected from the middle region of FGF14. Peptide sequence ENYYVIYSSMLYRQQESGRAWFLGLNKEGQAMKGNRVKKTKPAAHFLPKP. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
RUO | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
bA397O8.2, FGF-14, FHF4FHF-4, fibroblast growth factor 14, Fibroblast growth factor homologous factor 4, SCA27MGC119129 | |
FGF14 | |
IgG | |
Affinity Purified | |
28 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title