Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FGFBP2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP17984620UL

 View more versions of this product

Catalog No. NBP17984620


Add to cart

Description

Description

FGFBP2 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

FGFBP2
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
FGFBP2
Synthetic peptide directed towards the C terminal of human FGFBP2The immunogen for this antibody is FGFBP2. Peptide sequence LGKAKPTTRPTAKPTQPGPRPGGNEEAKKKAWEHCWKPFQALCAFLISFF.
24 kDa
20ul
Angiogenesis
Primary
83888
Western Blot
Western Blot 1:1000
NP_114156
37 kDa killer-specific secretory protein, FGF-binding protein 2, FGF-BP2, FGFBP-2, fibroblast growth factor binding protein 2, fibroblast growth factor-binding protein 2, HBp17-RP, HBP17RP, killer-specific secretory protein of 37 kDa, Ksp37, KSP37HBp17-related protein
Rabbit
IgG
Immunogen affinity purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human
SDS
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit