Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FGGY carbohydrate kinase domain containing Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP17927520UL

 View more versions of this product

Catalog No. NBP17927520


Add to cart

Description

Description

FGGY carbohydrate kinase domain containing Polyclonal antibody specifically detects Antigen in Mouse samples. It is validated for Western Blotting.
Specifications

Specifications

FGGY carbohydrate kinase domain containing
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
FGGY
The specific Immunogen is proprietary information. Peptide sequence NETKHRVLQYVGGVMSVEMQAPKLLWLKENLREICWDKAGHFFDLPDFLS.
Immunogen affinity purified
RUO
Primary
55277
Western Blot
Western Blot 1:1000
NP_083623
EC 2.7.1, EC 2.7.1.-, FGGY carbohydrate kinase domain containing, FGGY carbohydrate kinase domain-containing protein, FLJ10986
Rabbit
IgG
20ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Mouse
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit