Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FGGY carbohydrate kinase domain containing Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen FGGY carbohydrate kinase domain containing
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP179275
View Documents
Novus Biologicals
NBP179275
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

FGGY carbohydrate kinase domain containing Polyclonal specifically detects FGGY carbohydrate kinase domain containing in Mouse samples. It is validated for Western Blot.
Specifications

Specifications

FGGY carbohydrate kinase domain containing
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
EC 2.7.1, EC 2.7.1.-, FGGY carbohydrate kinase domain containing, FGGY carbohydrate kinase domain-containing protein, FLJ10986
FGGY
IgG
Affinity Purified
Western Blot
Unconjugated
RUO
NP_083623
55277
The specific Immunogen is proprietary information. Peptide sequence NETKHRVLQYVGGVMSVEMQAPKLLWLKENLREICWDKAGHFFDLPDFLS.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit