Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FGGY carbohydrate kinase domain containing Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | FGGY carbohydrate kinase domain containing |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP179275
|
Novus Biologicals
NBP179275 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
FGGY carbohydrate kinase domain containing Polyclonal specifically detects FGGY carbohydrate kinase domain containing in Mouse samples. It is validated for Western Blot.Specifications
| FGGY carbohydrate kinase domain containing | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| EC 2.7.1, EC 2.7.1.-, FGGY carbohydrate kinase domain containing, FGGY carbohydrate kinase domain-containing protein, FLJ10986 | |
| FGGY | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_083623 | |
| 55277 | |
| The specific Immunogen is proprietary information. Peptide sequence NETKHRVLQYVGGVMSVEMQAPKLLWLKENLREICWDKAGHFFDLPDFLS. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title