Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FIBB Monoclonal Antibody (6D12), Invitrogen™

Mouse Monoclonal Antibody

Supplier:  Thermo Scientific MA549187

Encompass

Catalog No. PIMA549187


Add to Cart

Description

Description

Adding 0.2 mL of distilled water will yield a concentration of 500 μg/mL. Immunogen sequence is different from the related mouse sequence by three amino acids, and from the related rat sequence by five amino acids.

FIBB Monoclonal antibody specifically detects FIBB in Human, Mouse, Non-human Primate, Rat samples. It is validated for Immunohistochemistry (Paraffin), Western Blot
TRUSTED_SUSTAINABILITY
Specifications

Specifications

FIBB
Monoclonal
500 μg/mL
PBS with 4MG trehalose and no preservative
P63101, P63102, P63104
Mouse
Antigen affinity chromatography
RUO
22631, 25578, 7534
Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
IgG2b
Immunohistochemistry (Paraffin), Western Blot
6D12
Unconjugated
Ywhaz
2510049G14Rik; Ab1-181; Ab1-216; Ac1-581; B beta polypeptide; beta-fibrinogen; epididymis secretory sperm binding protein Li 78p; Fgb; fibrinogen; Fibrinogen beta chain; fibrinogen, B beta polypeptide; fibrinogen, beta polypeptide; Fibrinopeptide B; HEL-S-78p; Liver regeneration-related protein LRRG036/LRRG043/LRRG189; MGC104327; MGC120405
A synthetic peptide corresponding to a sequence of human 14-3-3 zeta/delta (LLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQ).
100 μg
Primary
Human, Mouse, Non-human Primate, Rat
Lyophilized
Product Suggestions

Product Suggestions

SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit