Fibrillarin Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NBP157272	Novus Biologicals NBP157272	100 μL

Description

Fibrillarin Polyclonal specifically detects Fibrillarin in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Fibrillarin
• Classification: Polyclonal
• Form: Purified
• Regulatory Status: RUO
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 2.1.1,34-kD nucleolar scleroderma antigen, EC 2.1.1.-, EC 2.1.1.37, FIB, FIB1,34 kDa nucleolar scleroderma antigen, fibrillarin, FLRNrRNA 2'-O-methyltransferase fibrillarin, RNA, U3 small nucleolar interacting protein 1, RNU3IP1
• Gene Symbols: FBL
• Isotype: IgG
• Purification Method: Protein A purified
• Molecular Weight of Antigen: 35 kDa

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Host Species: Rabbit
• Research Discipline: Cellular Markers, Core ESC Like Genes, Neuroscience, Nuclear Envelope Markers, Stem Cell Markers
• Gene Accession No.: P22087
• Gene ID (Entrez): 2091
• Immunogen: Synthetic peptides corresponding to FBL (fibrillarin) The peptide sequence was selected from the N terminal of FBL. Peptide sequence GGGFHSGGNRGRGRGGKRGNQSGKNVMVEPHRHEGVFICRGKEDALVTKN.
• Primary or Secondary: Primary
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.