Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Fibrillarin Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen Fibrillarin
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Form Purified
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP157272
View Documents
Novus Biologicals
NBP157272
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

Fibrillarin Polyclonal specifically detects Fibrillarin in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications

Specifications

Fibrillarin
Polyclonal
Purified
RUO
PBS and 2% Sucrose with 0.09% Sodium Azide
EC 2.1.1,34-kD nucleolar scleroderma antigen, EC 2.1.1.-, EC 2.1.1.37, FIB, FIB1,34 kDa nucleolar scleroderma antigen, fibrillarin, FLRNrRNA 2'-O-methyltransferase fibrillarin, RNA, U3 small nucleolar interacting protein 1, RNU3IP1
FBL
IgG
Protein A purified
35 kDa
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Unconjugated
Rabbit
Cellular Markers, Core ESC Like Genes, Neuroscience, Nuclear Envelope Markers, Stem Cell Markers
P22087
2091
Synthetic peptides corresponding to FBL (fibrillarin) The peptide sequence was selected from the N terminal of FBL. Peptide sequence GGGFHSGGNRGRGRGGKRGNQSGKNVMVEPHRHEGVFICRGKEDALVTKN.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit