Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Ficolin-3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15802420UL
Description
Ficolin-3 Polyclonal specifically detects Ficolin-3 in Human samples. It is validated for Western Blot.Specifications
Ficolin-3 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
O75636 | |
FCN3 | |
Synthetic peptides corresponding to FCN3(ficolin (collagen/fibrinogen domain containing) 3 (Hakata antigen)) The peptide sequence was selected from the N terminal of FCN3. Peptide sequence LEASKVVLLPSCPGAPGSPGEKGAPGPQGPPGPPGKMGPKGEPGDPVNLL | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
Collagen/fibrinogen domain-containing lectin 3 p35, Collagen/fibrinogen domain-containing protein 3, FCNHficolin 3, ficolin (collagen/fibrinogen domain containing) 3 (Hakata antigen), ficolin (collagen/fibrinogen domain-containing) 3 (Hakata antigen), ficolin-3, HAKA1MGC22543, Hakata antigen, H-ficolin | |
Rabbit | |
Affinity Purified | |
RUO | |
8547 | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title