Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FKBP38 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | FKBP38 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15901920
|
Novus Biologicals
NBP15901920UL |
20 μL |
Each for $152.22
|
|
NBP159019
|
Novus Biologicals
NBP159019 |
100 μL |
Each for $436.00
|
|
Description
FKBP38 Polyclonal specifically detects FKBP38 in Human samples. It is validated for Western Blot.Specifications
| FKBP38 | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| Q14318 | |
| 23770 | |
| Synthetic peptides corresponding to FKBP8(FK506 binding protein 8, 38kDa) The peptide sequence was selected from the C terminal of FKBP8. Peptide sequence AIPILRAALKLEPSNKTIHAELSKLVKKHAAQRSTETALYRKMLGNPSRL. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| 38 kDa FK506-binding protein, EC 5.2.1.8,38 kDa FKBP, FK506 binding protein 8, 38kDa, FK506-binding protein 8, FK506-binding protein 8 (38kD), FKBP-38, FKBP38PPIase FKBP8, FKBP-8, FKBPr38, hFKBP38, peptidyl-prolyl cis-trans isomerase FKBP8, rotamase | |
| FKBP8 | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title