Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FKRP Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP16902920UL
Description
FKRP Polyclonal specifically detects FKRP in Mouse samples. It is validated for Western Blot.Specifications
FKRP | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q8CG64 | |
FKRP | |
Synthetic peptides corresponding to Fkrp (fukutin related protein) The peptide sequence was selected from the C terminal of Fkrp. Peptide sequence LDHRQDVEFPEHFLQPLVPLPFAGFMAQAPNNYRRFLELKFGPGVIENPE. | |
Affinity Purified | |
RUO | |
79147 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
EC 2.-, fukutin related protein, fukutin-related protein, LGMD2IFLJ12576, MDC1CMGC2991, MDDGA5, MDDGB5, MDDGC5 | |
Rabbit | |
55 kDa | |
20 μL | |
Primary | |
Mouse | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction