Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FKTN Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | FKTN |
---|---|
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Form | Purified |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP159640
|
Novus Biologicals
NBP159640 |
100 μL |
Each of 1 for $436.00
|
|
Description
FKTN Polyclonal specifically detects FKTN in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
FKTN | |
Polyclonal | |
Purified | |
RUO | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
CMD1X, EC 2.-, FCMDMGC134945, fukutin, Fukuyama type congenital muscular dystrophy (fukutin), Fukuyama type congenital muscular dystrophy protein, Fukuyama-type congenital muscular dystrophy protein, LGMD2MMGC134944, MDDGA4, MDDGB4, MDDGC4, MGC126857, MGC138243 | |
FKTN | |
IgG | |
Protein A purified | |
51 kDa |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
Rabbit | |
Neuroscience | |
O75072 | |
2218 | |
Synthetic peptides corresponding to FKTN The peptide sequence was selected from the N terminal of FKTN. Peptide sequence TAFALQYHLWKNEEGWFRIAENMGFQCLKIESKDPRLDGIDSLSGTEIPL. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title