Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FKTN Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$149.00 - $299.00
Specifications
| Antigen | FKTN |
|---|---|
| Immunogen | Synthetic peptides corresponding to FKTN The peptide sequence was selected from the N terminal of FKTN. Peptide sequence TAFALQYHLWKNEEGWFRIAENMGFQCLKIESKDPRLDGIDSLSGTEIPL. |
| Host Species | Rabbit |
| Primary or Secondary | Primary |
| Monoclonal or Polyclonal | Polyclonal |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
| NBP15964020 |
Novus Biologicals
NBP15964020UL |
20ul |
Each for $149.00
|
|
NBP159640 |
Novus Biologicals
NBP159640 |
100ul |
Each for $299.00
|
|
Description
FKTN Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blotting.Specifications
| FKTN | |
| Rabbit | |
| Polyclonal | |
| Unconjugated | |
| 2218 | |
| Purified | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| RUO |
| Synthetic peptides corresponding to FKTN The peptide sequence was selected from the N terminal of FKTN. Peptide sequence TAFALQYHLWKNEEGWFRIAENMGFQCLKIESKDPRLDGIDSLSGTEIPL. | |
| Primary | |
| IgG | |
| CMD1X, EC 2.-, FCMDMGC134945, fukutin, Fukuyama type congenital muscular dystrophy (fukutin), Fukuyama type congenital muscular dystrophy protein, Fukuyama-type congenital muscular dystrophy protein, LGMD2MMGC134944, MDDGA4, MDDGB4, MDDGC4, MGC126857, MGC138243 | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| Protein A purified | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title