Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FKTN Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen FKTN
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Form Purified
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP159640
View Documents
Novus Biologicals
NBP159640
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

FKTN Polyclonal specifically detects FKTN in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications

Specifications

FKTN
Polyclonal
Purified
RUO
PBS and 2% Sucrose with 0.09% Sodium Azide
CMD1X, EC 2.-, FCMDMGC134945, fukutin, Fukuyama type congenital muscular dystrophy (fukutin), Fukuyama type congenital muscular dystrophy protein, Fukuyama-type congenital muscular dystrophy protein, LGMD2MMGC134944, MDDGA4, MDDGB4, MDDGC4, MGC126857, MGC138243
FKTN
IgG
Protein A purified
51 kDa
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Unconjugated
Rabbit
Neuroscience
O75072
2218
Synthetic peptides corresponding to FKTN The peptide sequence was selected from the N terminal of FKTN. Peptide sequence TAFALQYHLWKNEEGWFRIAENMGFQCLKIESKDPRLDGIDSLSGTEIPL.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit