Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FLI1 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP257756

Catalog No. NBP257756


Add to Cart

Description

Description

FLI1 Polyclonal specifically detects FLI1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications

Specifications

FLI1
Polyclonal
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
EWSR2, Friend leukemia integration 1 transcription factor, Friend leukemia virus integration 1, Proto-oncogene Fli-1, SIC-1, Transcription factor ERGB
Rabbit
Affinity Purified
RUO
Primary
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Immunocytochemistry, Immunofluorescence
Unconjugated
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
FLI1
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SYLRESSLLAYNTTSHTDQSSRLSVKEDPSYDSVRRGAWGNNMNSGLNKSPPLGGAQTISKNT
100 μL
Cancer, Tumor Suppressors
2313
Human
IgG
Product Suggestions

Product Suggestions

SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only