FLJ10769 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP162516

Catalog No. NBP162516

Description

FLJ10769 Polyclonal specifically detects FLJ10769 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: FLJ10769
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: carbohydrate kinase domain containing, carbohydrate kinase domain-containing protein, FLJ10769, FLJ34548, FLJ52550, LP3298
• Host Species: Rabbit
• Molecular Weight of Antigen: 41 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Yeast: 85%; Zebrafish: 77%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: CARKD
• Immunogen: Synthetic peptides corresponding to CARKD (carbohydrate kinase domain containing) The peptide sequence was selected from the middle region of CARKD. Peptide sequence RLHALVVGPGLGRDDALLRNVQGILEVSKARDIPVVIDADGLWLVAQQPA.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 55739
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.