Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FLJ14154 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen FLJ14154
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP179287
View Documents
Novus Biologicals
NBP179287
100 μL
Each for $436.00
Add to cart
 
NBP17928720
View Documents
Novus Biologicals
NBP17928720UL
20 μL This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. N/A
Description

Description

FLJ14154 Polyclonal specifically detects FLJ14154 in Human samples. It is validated for Western Blot.
Specifications

Specifications

FLJ14154
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
EC 2.3.1, EC 2.3.1.-, FLJ11693, FLJ14154, N-acetyltransferase 15, N-acetyltransferase 15 (GCN5-related, putative)
NAA60
IgG
Affinity Purified
Western Blot
Unconjugated
RUO
NP_001077070
79903
Synthetic peptide directed towards the middle region of human NAT15. Peptide sequence DYIQHLGSALASLSPCSIPHRVYRQAHSLLCSFLPWSGISSKSGIEYSRT.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit