Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FLJ37543 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | FLJ37543 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP179600
|
Novus Biologicals
NBP179600 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
FLJ37543 Polyclonal specifically detects FLJ37543 in Human samples. It is validated for Western Blot.Specifications
| FLJ37543 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| NP_775938 | |
| 285668 | |
| Synthetic peptide directed towards the middle region of human FLJ37543The immunogen for this antibody is FLJ37543. Peptide sequence PAVFYNQYFKHPKCVGEYGPKNGAERQIEERKVLPTTMMFSMLADCVLKS. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| chromosome 5 open reading frame 64 | |
| C5orf64 | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title