Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FLVCR Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP19145620UL

 View more versions of this product

Catalog No. NBP19145620


Add to cart

Description

Description

FLVCR Polyclonal antibody specifically detects Antigen in Mouse samples. It is validated for Western Blotting.
Specifications

Specifications

FLVCR
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
FLVCR1
The specific Immunogen is proprietary information. Peptide sequence GPKEVSTACATAVLGNQLGTAVGFLLPPVLVPALGTQNSTGLLAHTQNNT.
60 kDa
20ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Mouse
Western Blot
Western Blot 1:1000
NP_001074728
ataxia, posterior column 1, with retinitis pigmentosa, AXPC1, feline leukemia virus subgroup C cellular receptor 1, Feline leukemia virus subgroup C receptor, feline leukemia virus subgroup C receptor-related protein 1, FLVCRFLJ33420, hFLVCR, MFSD7B, PCA, PCARP
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
28982
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit