Invitrogen™ FMO2 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA595318

Catalog No. PIPA595318

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat lung tissue, mouse lung tissue. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

The flavin-containing monooxygenases are NADPH-dependent enzymes that catalyze the oxidation of many drugs and xenobiotics. In most mammals, there is a flavin-containing monooxygenase that catalyzes the N-oxidation of some primary alkylamines through an N-hydroxylamine intermediate. However, in humans, this enzyme is truncated and is probably rapidly degraded. The protein encoded by this gene represents the truncated form and apparently has no catalytic activity. A functional allele found in African Americans has been reported, but no sequence evidence has been deposited to support the finding. This gene is found in a cluster with the FMO1, FMO3, and FMO4 genes on chromosome 1.

Specifications

• Antigen: FMO2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: Fmo2
• Gene Alias: 2310008D08Rik; 2310042I22Rik; AW107733; Dimethylaniline monooxygenase [N-oxide-forming] 2; dimethylaniline oxidase 2; flavin containing dimethylaniline monoxygenase 2; flavin containing monooxygenase 2; flavin containing monooxygenase 2 (non-functional); FMO 1B1; FMO 2; FMO, pulmonary; FMO1B1; FMO2; Pulmonary flavin-containing monooxygenase 2
• Host Species: Rabbit
• Purification Method: Affinity Chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 2327, 246245, 55990
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and no preservative
• Gene Accession No.: Q6IRI9, Q8K2I3, Q99518
• Gene Symbols: Fmo2
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human FMO2 (78-115aa FPNFLHNSKLLEYFRIFAKKFDLLKYIQFQTTVLSVRK).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG